Buy Glow Blend BPC-157 TB-500 GHK-Cu | Atomix Research
$89.99
Glow Blend triple-peptide complex (BPC-157 10mg + TB-500 10mg + GHK-Cu 50mg) for tissue repair and regeneration pathway research.
CAS No: BPC-157 : 300801-03-0 TB-500 : 77591-33-4 GHK-Cu : 300801-03-0
Mol. weight: BPC-157 : ~ 1419.5 g/mol TB-500 : ~ 4963 g/mol GHK-Cu : ~ 461.96 g/mol
Purity: >99% HPLC
Form: Blue lyophilized powder
Description
Research use only
Glow Blend combines BPC-157, TB-500 and GHK-Cu, studied together for their potential roles in tissue recovery, inflammation modulation and cellular regeneration. Research explores their combined influence on wound repair and collagen activity.
Supplied as a lyophilized blend. Store at –20°C away from moisture and light.
For laboratory research use only. Products are not for human consumption. Atomix Research is a chemical supplier and not a compounding pharmacy. All products are sold for research, laboratory, or analytical purposes only. You must be over 21 to purchase from this site.
| BPC-157 | Molecular Formula C62H98N16O22 , Sequence GEPPPGKPADDAGLV, CAS Number 137525-51-0 |
| TB-500 | Molecular Formula C212H350N56O78S, Sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, CAS Number 77591-33-4 |
| GHK-Cu | Molecular Formula C16H26CuN6O6, Sequence GHK, CAS Number 300801-03-0 |
